Recombinant Human GTF3C6 Protein, GST-tagged

Cat.No. : GTF3C6-4467H
Product Overview : Human GTF3C6 full-length ORF ( NP_612417.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : RNA polymerases are unable to initiate RNA synthesis in the absence of additional proteins called general transcription factors (GTFs). GTFs assemble in a complex on the DNA promoter and recruit the RNA polymerase. GTF3C family proteins (e.g., GTF3C1, MIM 603246) are essential for RNA polymerase III to make a number of small nuclear and cytoplasmic RNAs, including 5S RNA (MIM 180420), tRNA, and adenovirus-associated (VA) RNA of both cellular and viral origin.[supplied by OMIM
Molecular Mass : 50.4 kDa
AA Sequence : MAAAADERSPEDGEDEEEEEQLVLVELSGIIDSDFLSKCENKCKVLGIDTERPILQVDSCVFAGEYEDTLGTCVIFEENVEHADTEGNNKTVLKYKCHTMKKLSMTRTLLTEKKEGEENIGGVEWLQIKDNDFSYRPNMICNFLHENEDEEVVASAPDKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GTF3C6 general transcription factor IIIC, polypeptide 6, alpha 35kDa [ Homo sapiens ]
Official Symbol GTF3C6
Synonyms GTF3C6; general transcription factor IIIC, polypeptide 6, alpha 35kDa; C6orf51, chromosome 6 open reading frame 51; general transcription factor 3C polypeptide 6; bA397G5.3; TFIIIC35; TFIIIC 35 kDa subunit; transcription factor IIIC 35kDa; transcription factor IIIC subunit 6; transcription factor IIIC 35 kDa subunit; C6orf51;
Gene ID 112495
mRNA Refseq NM_138408
Protein Refseq NP_612417
MIM 611784
UniProt ID Q969F1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GTF3C6 Products

Required fields are marked with *

My Review for All GTF3C6 Products

Required fields are marked with *

0
cart-icon