Recombinant Full Length Human GTSF1 Protein, GST-tagged

• Cat.No.: GTSF1-3339HF
• Product Overview: Human GTSF1 full-length ORF ( NP_653195.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 167 amino acids
• Description: GTSF1 (Gametocyte Specific Factor 1) is a Protein Coding gene. An important paralog of this gene is GTSF1L.
• Molecular Mass: 45.6 kDa
• AA Sequence: MEETYTDSLDPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVPRAEISHHISSCDDRSCIEQDVVNQTRSLRQETLAESTWQCPPCDEDWDKDLWEQTSTPFAWGTTHYSDNNSPASNIVTEHKNNLASGMRVPKSLPYVLPWKNNGNAQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GTSF1 gametocyte specific factor 1 [ Homo sapiens ]
• Official Symbol: GTSF1
• Synonyms: GTSF1; gametocyte specific factor 1; FAM112B, family with sequence similarity 112, member B; gametocyte-specific factor 1; FLJ32942; family with sequence similarity 112, member B; FAM112B
• Gene ID: 121355
• mRNA Refseq: NM_144594
• Protein Refseq: NP_653195
• MIM: 617484
• UniProt ID: Q8WW33