Recombinant Human GTSF1 Protein, GST-tagged
| Cat.No. : | GTSF1-4481H |
| Product Overview : | Human GTSF1 full-length ORF ( NP_653195.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | GTSF1 (Gametocyte Specific Factor 1) is a Protein Coding gene. An important paralog of this gene is GTSF1L. |
| Molecular Mass : | 45.6 kDa |
| AA Sequence : | MEETYTDSLDPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVPRAEISHHISSCDDRSCIEQDVVNQTRSLRQETLAESTWQCPPCDEDWDKDLWEQTSTPFAWGTTHYSDNNSPASNIVTEHKNNLASGMRVPKSLPYVLPWKNNGNAQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GTSF1 gametocyte specific factor 1 [ Homo sapiens ] |
| Official Symbol | GTSF1 |
| Synonyms | GTSF1; gametocyte specific factor 1; FAM112B, family with sequence similarity 112, member B; gametocyte-specific factor 1; FLJ32942; family with sequence similarity 112, member B; FAM112B; |
| Gene ID | 121355 |
| mRNA Refseq | NM_144594 |
| Protein Refseq | NP_653195 |
| UniProt ID | Q8WW33 |
| ◆ Recombinant Proteins | ||
| GTSF1-1802H | Recombinant Human GTSF1 protein, GST-tagged | +Inquiry |
| GTSF1-6231H | Recombinant Human GTSF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| GTSF1-4005M | Recombinant Mouse GTSF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GTSF1-583C | Recombinant Cynomolgus GTSF1 Protein, His-tagged | +Inquiry |
| GTSF1-329C | Recombinant Cynomolgus Monkey GTSF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GTSF1-5679HCL | Recombinant Human GTSF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GTSF1 Products
Required fields are marked with *
My Review for All GTSF1 Products
Required fields are marked with *
