Recombinant Full Length Human GUCA1C Protein, GST-tagged

Cat.No. : GUCA1C-3341HF
Product Overview : Human GUCA1C full-length ORF ( NP_005450.2, 1 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 209 amino acids
Description : GUCA1C (Guanylate Cyclase Activator 1C) is a Protein Coding gene. Among its related pathways are Metabolism of fat-soluble vitamins and Phototransduction. GO annotations related to this gene include calcium ion binding and calcium sensitive guanylate cyclase activator activity. An important paralog of this gene is GUCA1A.
Molecular Mass : 50.2 kDa
AA Sequence : MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFIDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAVQALNGQQTLSPEEFINLVFHKIDINNDGELTLEEFINGMAKDQDLLEIVYKSFDFSNVLRVICNGKQPDMETDSSKSPDKAGLGKVKMK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GUCA1C guanylate cyclase activator 1C [ Homo sapiens ]
Official Symbol GUCA1C
Synonyms GUCA1C; guanylate cyclase activator 1C; guanylyl cyclase-activating protein 3; GCAP3; guanylyl cyclase activating protein 3; GCAP 3; MGC120158; MGC120159;
Gene ID 9626
mRNA Refseq NM_005459
Protein Refseq NP_005450
MIM 605128
UniProt ID O95843

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GUCA1C Products

Required fields are marked with *

My Review for All GUCA1C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon