Recombinant Human GUCA1C Protein, GST-tagged
Cat.No. : | GUCA1C-4485H |
Product Overview : | Human GUCA1C full-length ORF ( NP_005450.2, 1 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GUCA1C (Guanylate Cyclase Activator 1C) is a Protein Coding gene. Among its related pathways are Metabolism of fat-soluble vitamins and Phototransduction. GO annotations related to this gene include calcium ion binding and calcium sensitive guanylate cyclase activator activity. An important paralog of this gene is GUCA1A. |
Molecular Mass : | 50.2 kDa |
AA Sequence : | MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFIDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAVQALNGQQTLSPEEFINLVFHKIDINNDGELTLEEFINGMAKDQDLLEIVYKSFDFSNVLRVICNGKQPDMETDSSKSPDKAGLGKVKMK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GUCA1C guanylate cyclase activator 1C [ Homo sapiens ] |
Official Symbol | GUCA1C |
Synonyms | GUCA1C; guanylate cyclase activator 1C; guanylyl cyclase-activating protein 3; GCAP3; guanylyl cyclase activating protein 3; GCAP 3; MGC120158; MGC120159; |
Gene ID | 9626 |
mRNA Refseq | NM_005459 |
Protein Refseq | NP_005450 |
MIM | 605128 |
UniProt ID | O95843 |
◆ Recombinant Proteins | ||
GUCA1C-13616H | Recombinant Human GUCA1C, His-tagged | +Inquiry |
GUCA1C-3341HF | Recombinant Full Length Human GUCA1C Protein, GST-tagged | +Inquiry |
GUCA1C-4485H | Recombinant Human GUCA1C Protein, GST-tagged | +Inquiry |
GUCA1C-9743Z | Recombinant Zebrafish GUCA1C | +Inquiry |
◆ Cell & Tissue Lysates | ||
GUCA1C-5678HCL | Recombinant Human GUCA1C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GUCA1C Products
Required fields are marked with *
My Review for All GUCA1C Products
Required fields are marked with *
0
Inquiry Basket