Recombinant Full Length Human H2AFV Protein, GST-tagged
Cat.No. : | H2AFV-3403HF |
Product Overview : | Human H2AFV full-length ORF ( AAH00098, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 128 amino acids |
Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a member of the histone H2A family. Several transcript variants encoding different isoforms, have been identified for this gene. [provided by RefSeq |
Molecular Mass : | 39.82 kDa |
AA Sequence : | MAGGKAGRDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | H2AFV H2A histone family, member V [ Homo sapiens ] |
Official Symbol | H2AFV |
Synonyms | H2AFV; H2A histone family, member V; H2AV; histone H2A.V; MGC1947; MGC10170; MGC10831; H2A.F/Z; histone H2A.F/Z; purine-rich binding element protein B; FLJ26479; |
Gene ID | 94239 |
mRNA Refseq | NM_012412 |
Protein Refseq | NP_036544 |
MIM | 620008 |
UniProt ID | Q71UI9 |
◆ Recombinant Proteins | ||
H2AFV-4562H | Recombinant Human H2AFV protein, His-SUMO-tagged | +Inquiry |
H2AFV-4536H | Recombinant Human H2AFV Protein, GST-tagged | +Inquiry |
H2AFV-13645H | Recombinant Human H2AFV, His-tagged | +Inquiry |
H2AFV-3403HF | Recombinant Full Length Human H2AFV Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
H2AFV-5661HCL | Recombinant Human H2AFV 293 Cell Lysate | +Inquiry |
H2AFV-5660HCL | Recombinant Human H2AFV 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All H2AFV Products
Required fields are marked with *
My Review for All H2AFV Products
Required fields are marked with *