Recombinant Human H2AFV Protein, GST-tagged

Cat.No. : H2AFV-4536H
Product Overview : Human H2AFV full-length ORF ( AAH00098, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a member of the histone H2A family. Several transcript variants encoding different isoforms, have been identified for this gene. [provided by RefSeq
Molecular Mass : 39.82 kDa
AA Sequence : MAGGKAGRDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name H2AFV H2A histone family, member V [ Homo sapiens ]
Official Symbol H2AFV
Synonyms H2AFV; H2A histone family, member V; H2AV; histone H2A.V; MGC1947; MGC10170; MGC10831; H2A.F/Z; histone H2A.F/Z; purine-rich binding element protein B; FLJ26479;
Gene ID 94239
mRNA Refseq NM_012412
Protein Refseq NP_036544
UniProt ID Q71UI9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All H2AFV Products

Required fields are marked with *

My Review for All H2AFV Products

Required fields are marked with *

0
cart-icon