Recombinant Human H2AFV protein, His-SUMO-tagged
Cat.No. : | H2AFV-4562H |
Product Overview : | Recombinant Human H2AFV protein(Q71UI9)(1-128aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-128aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.5 kDa |
AA Sequence : | MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | H2AFV H2A histone family, member V [ Homo sapiens ] |
Official Symbol | H2AFV |
Synonyms | H2AFV; H2A histone family, member V; H2AV; histone H2A.V; MGC1947; MGC10170; MGC10831; H2A.F/Z; histone H2A.F/Z; purine-rich binding element protein B; FLJ26479; |
Gene ID | 94239 |
mRNA Refseq | NM_012412 |
Protein Refseq | NP_036544 |
UniProt ID | Q71UI9 |
◆ Recombinant Proteins | ||
H2AFV-4562H | Recombinant Human H2AFV protein, His-SUMO-tagged | +Inquiry |
H2AFV-3403HF | Recombinant Full Length Human H2AFV Protein, GST-tagged | +Inquiry |
H2AFV-4536H | Recombinant Human H2AFV Protein, GST-tagged | +Inquiry |
H2AFV-13645H | Recombinant Human H2AFV, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
H2AFV-5660HCL | Recombinant Human H2AFV 293 Cell Lysate | +Inquiry |
H2AFV-5661HCL | Recombinant Human H2AFV 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All H2AFV Products
Required fields are marked with *
My Review for All H2AFV Products
Required fields are marked with *