Recombinant Full Length Human HAGHL Protein, GST-tagged
| Cat.No. : | HAGHL-3449HF |
| Product Overview : | Human HAGHL full-length ORF ( AAH15008.1, 1 a.a. - 203 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 203 amino acids |
| Description : | HAGHL (Hydroxyacylglutathione Hydrolase-Like) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity and hydroxyacylglutathione hydrolase activity. An important paralog of this gene is HAGH. |
| Molecular Mass : | 48.5 kDa |
| AA Sequence : | MKVKVIPVLEDNYMYLVIEELTREAVAVDVAVPKRLLEIVGREGVSLTAVLTTHHHWDHARGNPELARLRPGLAVLGADERIFSLTRRLAHGEELRVSARSREGRGGRPGSTRPHRSACSSAAVRGHPRALPPDARPHRRPHELLPVGGRLPGPTRPVLGRRAVGGRLRLVPGGQRPADVPEPGRAGYPAPRDEGVLRPRAHA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HAGHL hydroxyacylglutathione hydrolase-like [ Homo sapiens ] |
| Official Symbol | HAGHL |
| Synonyms | HAGHL; hydroxyacylglutathione hydrolase-like; hydroxyacyl glutathione hydrolase like; hydroxyacylglutathione hydrolase-like protein; MGC2605; GLO2-like/ RJD12; |
| Gene ID | 84264 |
| mRNA Refseq | NM_032304 |
| Protein Refseq | NP_115680 |
| UniProt ID | Q6PII5 |
| ◆ Recombinant Proteins | ||
| HAGHL-3449HF | Recombinant Full Length Human HAGHL Protein, GST-tagged | +Inquiry |
| HAGHL-4561H | Recombinant Human HAGHL Protein, GST-tagged | +Inquiry |
| HAGHL-6752H | Recombinant Human HAGHL protein, His-tagged | +Inquiry |
| HAGHL-2344C | Recombinant Chicken HAGHL | +Inquiry |
| Haghl-3353M | Recombinant Mouse Haghl Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HAGHL-5642HCL | Recombinant Human HAGHL 293 Cell Lysate | +Inquiry |
| HAGHL-5643HCL | Recombinant Human HAGHL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAGHL Products
Required fields are marked with *
My Review for All HAGHL Products
Required fields are marked with *
