Recombinant Full Length Human HAGHL Protein, GST-tagged

Cat.No. : HAGHL-3449HF
Product Overview : Human HAGHL full-length ORF ( AAH15008.1, 1 a.a. - 203 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 203 amino acids
Description : HAGHL (Hydroxyacylglutathione Hydrolase-Like) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity and hydroxyacylglutathione hydrolase activity. An important paralog of this gene is HAGH.
Molecular Mass : 48.5 kDa
AA Sequence : MKVKVIPVLEDNYMYLVIEELTREAVAVDVAVPKRLLEIVGREGVSLTAVLTTHHHWDHARGNPELARLRPGLAVLGADERIFSLTRRLAHGEELRVSARSREGRGGRPGSTRPHRSACSSAAVRGHPRALPPDARPHRRPHELLPVGGRLPGPTRPVLGRRAVGGRLRLVPGGQRPADVPEPGRAGYPAPRDEGVLRPRAHA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HAGHL hydroxyacylglutathione hydrolase-like [ Homo sapiens ]
Official Symbol HAGHL
Synonyms HAGHL; hydroxyacylglutathione hydrolase-like; hydroxyacyl glutathione hydrolase like; hydroxyacylglutathione hydrolase-like protein; MGC2605; GLO2-like/ RJD12;
Gene ID 84264
mRNA Refseq NM_032304
Protein Refseq NP_115680
UniProt ID Q6PII5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HAGHL Products

Required fields are marked with *

My Review for All HAGHL Products

Required fields are marked with *

0
cart-icon