Recombinant Human HAGHL protein, His-tagged
Cat.No. : | HAGHL-6752H |
Product Overview : | Recombinant Human HAGHL protein(1-282 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-282 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MKVKVIPVLEDNYMYLVIEELTREAVAVDVAVPKRLLEIVGREGVSLTAVLTTHHHWDHARGNPELARLRPGLAVLGADERIFSLTRRLAHGEELRFGAIHVRCLLTPGHTAGHMSYFLWEDDCPDPPALFSGDALSVAGCGSCLEGSAQQMYQSLAELGTLPPETKVFCGHEHTLSNLEFAQKVEPCNDHVRAKLSWAKKRDEDDVPTVPSTLGEERLYNPFLRVAEEPVRKFTGKAVPADVLEALCKERARFEQAGEPRQPQARALLALQWGLLSAAPHD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | HAGHL hydroxyacylglutathione hydrolase-like [ Homo sapiens ] |
Official Symbol | HAGHL |
Synonyms | HAGHL; hydroxyacylglutathione hydrolase-like; hydroxyacyl glutathione hydrolase like; hydroxyacylglutathione hydrolase-like protein; MGC2605; GLO2-like/ RJD12; |
Gene ID | 84264 |
mRNA Refseq | NM_032304 |
Protein Refseq | NP_115680 |
UniProt ID | Q6PII5 |
◆ Recombinant Proteins | ||
HAGHL-4561H | Recombinant Human HAGHL Protein, GST-tagged | +Inquiry |
HAGHL-6752H | Recombinant Human HAGHL protein, His-tagged | +Inquiry |
HAGHL-3449HF | Recombinant Full Length Human HAGHL Protein, GST-tagged | +Inquiry |
HAGHL-2344C | Recombinant Chicken HAGHL | +Inquiry |
Haghl-3353M | Recombinant Mouse Haghl Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAGHL-5643HCL | Recombinant Human HAGHL 293 Cell Lysate | +Inquiry |
HAGHL-5642HCL | Recombinant Human HAGHL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAGHL Products
Required fields are marked with *
My Review for All HAGHL Products
Required fields are marked with *
0
Inquiry Basket