Recombinant Human HAGHL protein, His-tagged
| Cat.No. : | HAGHL-6752H |
| Product Overview : | Recombinant Human HAGHL protein(1-282 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-282 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | MKVKVIPVLEDNYMYLVIEELTREAVAVDVAVPKRLLEIVGREGVSLTAVLTTHHHWDHARGNPELARLRPGLAVLGADERIFSLTRRLAHGEELRFGAIHVRCLLTPGHTAGHMSYFLWEDDCPDPPALFSGDALSVAGCGSCLEGSAQQMYQSLAELGTLPPETKVFCGHEHTLSNLEFAQKVEPCNDHVRAKLSWAKKRDEDDVPTVPSTLGEERLYNPFLRVAEEPVRKFTGKAVPADVLEALCKERARFEQAGEPRQPQARALLALQWGLLSAAPHD |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | HAGHL hydroxyacylglutathione hydrolase-like [ Homo sapiens ] |
| Official Symbol | HAGHL |
| Synonyms | HAGHL; hydroxyacylglutathione hydrolase-like; hydroxyacyl glutathione hydrolase like; hydroxyacylglutathione hydrolase-like protein; MGC2605; GLO2-like/ RJD12; |
| Gene ID | 84264 |
| mRNA Refseq | NM_032304 |
| Protein Refseq | NP_115680 |
| UniProt ID | Q6PII5 |
| ◆ Recombinant Proteins | ||
| HAGHL-4561H | Recombinant Human HAGHL Protein, GST-tagged | +Inquiry |
| HAGHL-6752H | Recombinant Human HAGHL protein, His-tagged | +Inquiry |
| Haghl-3353M | Recombinant Mouse Haghl Protein, Myc/DDK-tagged | +Inquiry |
| HAGHL-2344C | Recombinant Chicken HAGHL | +Inquiry |
| HAGHL-3449HF | Recombinant Full Length Human HAGHL Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HAGHL-5643HCL | Recombinant Human HAGHL 293 Cell Lysate | +Inquiry |
| HAGHL-5642HCL | Recombinant Human HAGHL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAGHL Products
Required fields are marked with *
My Review for All HAGHL Products
Required fields are marked with *
