Recombinant Full Length Human HAND1 Protein, GST-tagged
| Cat.No. : | HAND1-3349HF |
| Product Overview : | Human HAND1 full-length ORF ( ABZ92217.1, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 215 amino acids |
| Description : | The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, it has been suggested that this transcription factor may be required for early trophoblast differentiation. [provided by RefSeq |
| Molecular Mass : | 23.7 kDa |
| AA Sequence : | MNLVGSYAHHHHHHHPHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGGPPPAAAAAATAYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRELQQHEGFPPALGPVEKRIKGRTGWPQQVWALELNQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HAND1 heart and neural crest derivatives expressed 1 [ Homo sapiens ] |
| Official Symbol | HAND1 |
| Synonyms | HAND1; heart and neural crest derivatives expressed 1; heart- and neural crest derivatives-expressed protein 1; bHLHa27; eHand; Hxt; Thing1; class A basic helix-loop-helix protein 27; extraembryonic tissues, heart, autonomic nervous system and neural crest derivatives-expressed protein 1; |
| Gene ID | 9421 |
| mRNA Refseq | NM_004821 |
| Protein Refseq | NP_004812 |
| MIM | 602406 |
| UniProt ID | O96004 |
| ◆ Recombinant Proteins | ||
| HAND1-3349HF | Recombinant Full Length Human HAND1 Protein, GST-tagged | +Inquiry |
| Hand1-7851M | Recombinant Mouse Hand1 protein, His & T7-tagged | +Inquiry |
| HAND1-7172H | Recombinant Human HAND1 protein, His-T7-tagged | +Inquiry |
| HAND1-2786R | Recombinant Rat HAND1 Protein | +Inquiry |
| HAND1-13662H | Recombinant Human HAND1, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HAND1-5639HCL | Recombinant Human HAND1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAND1 Products
Required fields are marked with *
My Review for All HAND1 Products
Required fields are marked with *
