Recombinant Full Length Human HBG1 Protein, GST-tagged
| Cat.No. : | HBG1-3494HF |
| Product Overview : | Human HBG1 full-length ORF ( AAH10913, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 147 amino acids |
| Description : | The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5-epsilon -- gamma-G -- gamma-A -- delta -- beta--3. [provided by RefSeq |
| Molecular Mass : | 41.91 kDa |
| AA Sequence : | MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAVMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HBG1 hemoglobin, gamma A [ Homo sapiens ] |
| Official Symbol | HBG1 |
| Synonyms | HBG1; hemoglobin, gamma A; hemoglobin subunit gamma-1; hb F Agamma; gamma globin; A-gamma globin; gamma-1-globin; gamma A hemoglobin; hemoglobin gamma-1 chain; hemoglobin gamma-a chain; hemoglobin, gamma, regulator of; HBGA; HBGR; HSGGL1; PRO2979; |
| Gene ID | 3047 |
| mRNA Refseq | NM_000559 |
| Protein Refseq | NP_000550 |
| MIM | 142200 |
| UniProt ID | P69891 |
| ◆ Recombinant Proteins | ||
| HBG1-1048H | Recombinant Human HBG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HBG1-20H | Recombinant Human HBG1 protein, His-Myc-tagged | +Inquiry |
| HBG1-1209C | Recombinant Chicken HBG1 | +Inquiry |
| HBG1-13683H | Recombinant Human HBG1, GST-tagged | +Inquiry |
| HBG1-3692H | Recombinant Human HBG1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HBG1-5620HCL | Recombinant Human HBG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HBG1 Products
Required fields are marked with *
My Review for All HBG1 Products
Required fields are marked with *



