Recombinant Human HBG1 protein, His-Myc-tagged

• Cat.No.: HBG1-20H
• Product Overview: Recombinant Human HBG1 protein(P69891)(2-147aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 2-147aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 23.0 kDa
• AA Sequence: GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYH
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: HBG1 hemoglobin, gamma A [ Homo sapiens ]
• Official Symbol: HBG1
• Synonyms: HBG1; hemoglobin, gamma A; hemoglobin subunit gamma-1; hb F Agamma; gamma globin; A-gamma globin; gamma-1-globin; gamma A hemoglobin; hemoglobin gamma-1 chain; hemoglobin gamma-a chain; hemoglobin, gamma, regulator of; HBGA; HBGR; HSGGL1; PRO2979
• Gene ID: 3047
• mRNA Refseq: NM_000559
• Protein Refseq: NP_000550
• MIM: 142200
• UniProt ID: P69891