Recombinant Human HBG1 protein, His-Myc-tagged
Cat.No. : | HBG1-20H |
Product Overview : | Recombinant Human HBG1 protein(P69891)(2-147aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 2-147aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 23.0 kDa |
AA Sequence : | GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYH |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HBG1 hemoglobin, gamma A [ Homo sapiens ] |
Official Symbol | HBG1 |
Synonyms | HBG1; hemoglobin, gamma A; hemoglobin subunit gamma-1; hb F Agamma; gamma globin; A-gamma globin; gamma-1-globin; gamma A hemoglobin; hemoglobin gamma-1 chain; hemoglobin gamma-a chain; hemoglobin, gamma, regulator of; HBGA; HBGR; HSGGL1; PRO2979; |
Gene ID | 3047 |
mRNA Refseq | NM_000559 |
Protein Refseq | NP_000550 |
MIM | 142200 |
UniProt ID | P69891 |
◆ Recombinant Proteins | ||
HBG1-62HFL | Recombinant Full Length Human HBG1 Protein, C-Flag-tagged | +Inquiry |
HBG1-7642H | Recombinant Human HBG1, His-tagged | +Inquiry |
HBG1-3494HF | Recombinant Full Length Human HBG1 Protein, GST-tagged | +Inquiry |
HBG1-1048H | Recombinant Human HBG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HBG1-4600H | Recombinant Human HBG1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HBG1-5620HCL | Recombinant Human HBG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HBG1 Products
Required fields are marked with *
My Review for All HBG1 Products
Required fields are marked with *