Recombinant Human HBG1 protein, His-tagged
| Cat.No. : | HBG1-3692H |
| Product Overview : | Recombinant Human HBG1 protein(1-118 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 16, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-118 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDATKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIH |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | HBG1 hemoglobin, gamma A [ Homo sapiens ] |
| Official Symbol | HBG1 |
| Synonyms | HBG1; hemoglobin, gamma A; hemoglobin subunit gamma-1; hb F Agamma; gamma globin; A-gamma globin; gamma-1-globin; gamma A hemoglobin; hemoglobin gamma-1 chain; hemoglobin gamma-a chain; hemoglobin, gamma, regulator of; HBGA; HBGR; HSGGL1; PRO2979; |
| Gene ID | 3047 |
| mRNA Refseq | NM_000559 |
| Protein Refseq | NP_000550 |
| MIM | 142200 |
| UniProt ID | P69891 |
| ◆ Recombinant Proteins | ||
| HBG1-13683H | Recombinant Human HBG1, GST-tagged | +Inquiry |
| HBG1-47H | Recombinant Human HBG1 Protein, Myc/DDK-tagged | +Inquiry |
| HBG1-1048H | Recombinant Human HBG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HBG1-3692H | Recombinant Human HBG1 protein, His-tagged | +Inquiry |
| HBG1-040H | Recombinant Human HBG1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HBG1-5620HCL | Recombinant Human HBG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HBG1 Products
Required fields are marked with *
My Review for All HBG1 Products
Required fields are marked with *
