Recombinant Full Length Human HCRTR1 Protein
| Cat.No. : | HCRTR1-3571HF |
| Product Overview : | Human HCRTR1 full-length ORF (AAH74796.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 1,210 amino acids |
| Description : | The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein selectively binds the hypothalamic neuropeptide orexin A. A related gene (HCRTR2) encodes a G-protein coupled receptor that binds orexin A and orexin B. [provided by RefSeq |
| Form : | Liquid |
| Molecular Mass : | 47.5 kDa |
| AA Sequence : | MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP |
| Applications : | Antibody Production Functional Study Compound Screening |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | HCRTR1 hypocretin (orexin) receptor 1 [ Homo sapiens ] |
| Official Symbol | HCRTR1 |
| Synonyms | HCRTR1; hypocretin (orexin) receptor 1; orexin receptor type 1; OX1R; ox1-R; ox-1-R; orexin receptor 1; orexin receptor-1; hypocretin receptor 1; hypocretin receptor-1; hypocretin receptor type 1; |
| Gene ID | 3061 |
| mRNA Refseq | NM_001525 |
| Protein Refseq | NP_001516 |
| MIM | 602392 |
| UniProt ID | O43613 |
| ◆ Recombinant Proteins | ||
| HCRTR1-2466R | Recombinant Rat HCRTR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HCRTR1-1124HFL | Recombinant Human HCRTR1 protein, His&Flag-tagged | +Inquiry |
| HCRTR1-7523M | Recombinant Mouse HCRTR1 Protein | +Inquiry |
| HCRTR1-4634H | Recombinant Human HCRTR1 Protein, GST-tagged | +Inquiry |
| HCRTR1-2463H | Recombinant Human HCRTR1 Protein (1-46 aa), His-Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HCRTR1-5609HCL | Recombinant Human HCRTR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HCRTR1 Products
Required fields are marked with *
My Review for All HCRTR1 Products
Required fields are marked with *
