Recombinant Full Length Human HDAC11 Protein, C-Flag-tagged
Cat.No. : | HDAC11-934HFL |
Product Overview : | Recombinant Full Length Human HDAC11 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a class IV histone deacetylase. The encoded protein is localized to the nucleus and may be involved in regulating the expression of interleukin 10. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 39 kDa |
AA Sequence : | MLHTTQLYQHVPETRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVINFLKEEKLLSDSMLVEAREASEED LLVVHTRRYLNELKWSFAVATITEIPPVIFLPNFLVQRKVLRPLRTQTGGTIMAGKLAVERGWAINVGGG FHHCSSDRGGGFCAYADITLAIKFLFERVEGISRATIIDLDAHQGNGHERDFMDDKRVYIMDVYNRHIYP GDRFAKQAIRRKVELEWGTEDDEYLDKVERNIKKSLQEHLPDVVVYNAGTDILEGDRLGGLSISPAGIVK RDELVFRMVRGRRVPILMVTSGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTPLLPPAVPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Full Length : | Full L. |
Gene Name | HDAC11 histone deacetylase 11 [ Homo sapiens (human) ] |
Official Symbol | HDAC11 |
Synonyms | HD11 |
Gene ID | 79885 |
mRNA Refseq | NM_024827.4 |
Protein Refseq | NP_079103.2 |
MIM | 607226 |
UniProt ID | Q96DB2 |
◆ Recombinant Proteins | ||
HDAC11-35MFL | Active Recombinant Full Length Mouse HDAC11 Protein, N-GST-tagged | +Inquiry |
HDAC11-643H | Recombinant Human HDAC11 protein, His-tagged | +Inquiry |
HDAC11-402H | Active Recombinant Human Histone Deacetylase 11, His-tagged | +Inquiry |
HDAC11-586C | Recombinant Cynomolgus HDAC11 Protein, His-tagged | +Inquiry |
HDAC11-332C | Recombinant Cynomolgus Monkey HDAC11 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HDAC11-5606HCL | Recombinant Human HDAC11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HDAC11 Products
Required fields are marked with *
My Review for All HDAC11 Products
Required fields are marked with *
0
Inquiry Basket