Recombinant Full Length Human HDHD2 Protein, GST-tagged
Cat.No. : | HDHD2-3443HF |
Product Overview : | Human HDHD2 full-length ORF ( NP_115500.1, 1 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 259 amino acids |
Description : | HDHD2 (Haloacid Dehalogenase Like Hydrolase Domain Containing 2) is a Protein Coding gene. GO annotations related to this gene include enzyme binding. An important paralog of this gene is LHPP. |
Molecular Mass : | 54.9 kDa |
AA Sequence : | MAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDHILQHLL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HDHD2 haloacid dehalogenase-like hydrolase domain containing 2 [ Homo sapiens ] |
Official Symbol | HDHD2 |
Synonyms | HDHD2; haloacid dehalogenase-like hydrolase domain containing 2; haloacid dehalogenase-like hydrolase domain-containing protein 2; DKFZP564D1378; 3110052N05Rik; DKFZp564D1378; |
Gene ID | 84064 |
mRNA Refseq | NM_032124 |
Protein Refseq | NP_115500 |
UniProt ID | Q9H0R4 |
◆ Recombinant Proteins | ||
HDHD2-29213TH | Recombinant Human HDHD2, His-tagged | +Inquiry |
HDHD2-7543M | Recombinant Mouse HDHD2 Protein | +Inquiry |
Hdhd2-3374M | Recombinant Mouse Hdhd2 Protein, Myc/DDK-tagged | +Inquiry |
HDHD2-4664H | Recombinant Human HDHD2 Protein, GST-tagged | +Inquiry |
HDHD2-1701H | Recombinant Human Haloacid Dehalogenase-Like Hydrolase Domain Containing 2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HDHD2-5595HCL | Recombinant Human HDHD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HDHD2 Products
Required fields are marked with *
My Review for All HDHD2 Products
Required fields are marked with *