Recombinant Human HDHD2 Protein, GST-tagged

Cat.No. : HDHD2-4664H
Product Overview : Human HDHD2 full-length ORF ( NP_115500.1, 1 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : HDHD2 (Haloacid Dehalogenase Like Hydrolase Domain Containing 2) is a Protein Coding gene. GO annotations related to this gene include enzyme binding. An important paralog of this gene is LHPP.
Molecular Mass : 54.9 kDa
AA Sequence : MAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDHILQHLL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HDHD2 haloacid dehalogenase-like hydrolase domain containing 2 [ Homo sapiens ]
Official Symbol HDHD2
Synonyms HDHD2; haloacid dehalogenase-like hydrolase domain containing 2; haloacid dehalogenase-like hydrolase domain-containing protein 2; DKFZP564D1378; 3110052N05Rik; DKFZp564D1378;
Gene ID 84064
mRNA Refseq NM_032124
Protein Refseq NP_115500
UniProt ID Q9H0R4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HDHD2 Products

Required fields are marked with *

My Review for All HDHD2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon