Recombinant Full Length Human HES1 Protein, C-Flag-tagged
Cat.No. : | HES1-1831HFL |
Product Overview : | Recombinant Full Length Human HES1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 29.4 kDa |
AA Sequence : | MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSS RHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLL GHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAG EAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Adult stem cells, Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Stem cell relevant signaling - DSL/Notch pathway, Transcription Factors |
Protein Pathways : | Maturity onset diabetes of the young, Notch signaling pathway |
Full Length : | Full L. |
Gene Name | HES1 hes family bHLH transcription factor 1 [ Homo sapiens (human) ] |
Official Symbol | HES1 |
Synonyms | HHL; HRY; HES-1; bHLHb39 |
Gene ID | 3280 |
mRNA Refseq | NM_005524.4 |
Protein Refseq | NP_005515.1 |
MIM | 139605 |
UniProt ID | Q14469 |
◆ Recombinant Proteins | ||
HES1-26539TH | Recombinant Human HES1 | +Inquiry |
HES1-1062H | Recombinant Human HES1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HES1-4699H | Recombinant Human HES1 Protein, GST-tagged | +Inquiry |
Hes1-1111M | Recombinant Mouse Hes1 Protein, MYC/DDK-tagged | +Inquiry |
HES1-2829R | Recombinant Rat HES1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HES1-5582HCL | Recombinant Human HES1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HES1 Products
Required fields are marked with *
My Review for All HES1 Products
Required fields are marked with *
0
Inquiry Basket