Recombinant Full Length Human HEXIM2 Protein, GST-tagged

Cat.No. : HEXIM2-3527HF
Product Overview : Human HEXIM2 full-length ORF ( NP_653209.1, 1 a.a. - 286 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 286 amino acids
Description : This gene encodes a member of the HEXIM family of proteins. This protein is a component of the 7SK small nuclear ribonucleoprotein. This protein has been found to negatively regulate the kinase activity of the cyclin-dependent kinase P-TEFb, which phosphorylates multiple target proteins to promote transcriptional elongation. This gene is located approximately 7 kb downstream from related family member HEXIM1 on chromosome 17. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015]
Molecular Mass : 58.8 kDa
AA Sequence : MMATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMESHSEDEDLAGAVGGLGWNSRSPRTQSPGGCSAEAVLARKKHRRRPSKRKRHWRPYLELSWAEKQQRDERQSQRASRVREEMFAKGQPVAPYNTTQFLMNDRDPEEPNLDVPHGISHPGSSGESEAGDSDGRGRAHGEFQRKDFSETYERFHTESLQGRSKQELVRDYLELEKRLSQAEEETRRLQQLQACTGQQSCRQVEELAAEVQRLRTENQRLRQENQMWNREGCRCDEEPGT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HEXIM2 hexamethylene bis-acetamide inducible 2 [ Homo sapiens ]
Official Symbol HEXIM2
Synonyms HEXIM2; hexamethylene bis-acetamide inducible 2; protein HEXIM2; FLJ32384; MAQ1 paralog; hexamthylene bis-acetamide inducible 2; hexamethylene bis-acetamide-inducible protein 2; hexamethylene-bis-acetamide-inducible transcript 2; L3;
Gene ID 124790
mRNA Refseq NM_144608
Protein Refseq NP_653209
MIM 615695
UniProt ID Q96MH2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HEXIM2 Products

Required fields are marked with *

My Review for All HEXIM2 Products

Required fields are marked with *

0
cart-icon
0
compare icon