Recombinant Full Length Human HGSNAT Protein, GST-tagged
Cat.No. : | HGSNAT-3538HF |
Product Overview : | Human HGSNAT full-length ORF ( AAH12452.1, 1 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 206 amino acids |
Description : | This gene encodes a lysosomal acetyltransferase, which is one of several enzymes involved in the lysosomal degradation of heparin sulfate. Mutations in this gene are associated with Sanfilippo syndrome C, one type of the lysosomal storage disease mucopolysaccaridosis III, which results from impaired degradation of heparan sulfate. [provided by RefSeq |
Molecular Mass : | 48.7 kDa |
AA Sequence : | MALGLCRCFHPRHSMAAFGLFPALPSALNSHPACTCLLDPSTWRPAHVSGPALASSPQILSVFSLGFPGFVNGSCVSRYKPDIIFPPGLPPPDLPSSVSIFYLQLLCSHGHCCITESGPLLSFSNWPPSLVPHFLKSPVHCHQIKLSPARSPLSEKPPLTWKHHCLAHILTYSPSRLDPHTSFQPPLPLHSLLPPPPPHPLVSPPL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HGSNAT heparan-alpha-glucosaminide N-acetyltransferase [ Homo sapiens (human) ] |
Official Symbol | HGSNAT |
Synonyms | HGSNAT; heparan-alpha-glucosaminide N-acetyltransferase; RP73; HGNAT; MPS3C; TMEM76; heparan-alpha-glucosaminide N-acetyltransferase; transmembrane protein 76; EC 2.3.1.78 |
Gene ID | 138050 |
mRNA Refseq | NM_152419 |
Protein Refseq | NP_689632 |
MIM | 610453 |
UniProt ID | Q68CP4 |
◆ Recombinant Proteins | ||
HGSNAT-7608M | Recombinant Mouse HGSNAT Protein | +Inquiry |
HGSNAT-3538HF | Recombinant Full Length Human HGSNAT Protein, GST-tagged | +Inquiry |
HGSNAT-4148M | Recombinant Mouse HGSNAT Protein, His (Fc)-Avi-tagged | +Inquiry |
HGSNAT-4734H | Recombinant Human HGSNAT Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HGSNAT Products
Required fields are marked with *
My Review for All HGSNAT Products
Required fields are marked with *
0
Inquiry Basket