Recombinant Human HGSNAT Protein, GST-tagged

Cat.No. : HGSNAT-4734H
Product Overview : Human HGSNAT full-length ORF ( AAH12452.1, 1 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a lysosomal acetyltransferase, which is one of several enzymes involved in the lysosomal degradation of heparin sulfate. Mutations in this gene are associated with Sanfilippo syndrome C, one type of the lysosomal storage disease mucopolysaccaridosis III, which results from impaired degradation of heparan sulfate. [provided by RefSeq
Molecular Mass : 48.7 kDa
AA Sequence : MALGLCRCFHPRHSMAAFGLFPALPSALNSHPACTCLLDPSTWRPAHVSGPALASSPQILSVFSLGFPGFVNGSCVSRYKPDIIFPPGLPPPDLPSSVSIFYLQLLCSHGHCCITESGPLLSFSNWPPSLVPHFLKSPVHCHQIKLSPARSPLSEKPPLTWKHHCLAHILTYSPSRLDPHTSFQPPLPLHSLLPPPPPHPLVSPPL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HGSNAT heparan-alpha-glucosaminide N-acetyltransferase [ Homo sapiens (human) ]
Official Symbol HGSNAT
Synonyms HGSNAT; heparan-alpha-glucosaminide N-acetyltransferase; RP73; HGNAT; MPS3C; TMEM76; heparan-alpha-glucosaminide N-acetyltransferase; transmembrane protein 76; EC 2.3.1.78
Gene ID 138050
mRNA Refseq NM_152419
Protein Refseq NP_689632
MIM 610453
UniProt ID Q68CP4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HGSNAT Products

Required fields are marked with *

My Review for All HGSNAT Products

Required fields are marked with *

0
cart-icon
0
compare icon