Recombinant Full Length Human HisT4H4 Protein, His-tagged
Cat.No. : | HIST4H4-229HF |
Product Overview : | Recombinant full length Human Histone H4 with a proprietary tag; Predicted MWt 37.44 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | His |
Protein Length : | 103 amino acids |
Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. |
Form : | Liquid |
Molecular Mass : | 37.440kDa inclusive of tags |
AA Sequence : | MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | HIST4H4 histone cluster 4, H4 [ Homo sapiens ] |
Official Symbol | HIST4H4 |
Synonyms | HIST4H4; histone cluster 4, H4; histone 4, H4; histone H4; MGC24116 |
Gene ID | 121504 |
mRNA Refseq | NM_175054 |
Protein Refseq | NP_778224 |
MIM | 615069 |
UniProt ID | P62805 |
◆ Recombinant Proteins | ||
Hist4h4-372M | Recombinant Mouse Hist4h4 Protein, His-tagged | +Inquiry |
HIST4H4-490H | Recombinant Human HIST4H4 protein | +Inquiry |
HIST4H4-4819H | Recombinant Human HIST4H4 Protein, GST-tagged | +Inquiry |
HIST4H4-401H | Recombinant Human HIST4H4 Protein, MYC/DDK-tagged | +Inquiry |
HIST4H4-29325TH | Recombinant Human HisT4H4, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIST4H4-5510HCL | Recombinant Human HIST4H4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HIST4H4 Products
Required fields are marked with *
My Review for All HIST4H4 Products
Required fields are marked with *
0
Inquiry Basket