Recombinant Full Length Human HLA-E Protein, C-Flag-tagged
Cat.No. : | HLA-E-268HFL |
Product Overview : | Recombinant Full Length Human HLA-E Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | HLA-E belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-E binds a restricted subset of peptides derived from the leader peptides of other class I molecules. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 37.8 kDa |
AA Sequence : | MVDGTLLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRA PWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYD GKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHV THHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTC HVQHEGLPEPVTLRWKPASQPTIPIVGIIAGLVLLGSVVSGAVVAAVIWRKKSSGGKGGSYSKAEWSDSA QGSESHSLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Protein Pathways : | Allograft rejection, Antigen processing and presentation, Autoimmune thyroid disease, Cell adhesion molecules (CAMs), Endocytosis, Graft-versus-host disease, Natural killer cell mediated cytotoxicity, Type I diabetes mellitus, Viral myocarditis |
Full Length : | Full L. |
Gene Name | HLA-E major histocompatibility complex, class I, E [ Homo sapiens (human) ] |
Official Symbol | HLA-E |
Synonyms | QA1; HLA-6.2 |
Gene ID | 3133 |
mRNA Refseq | NM_005516.6 |
Protein Refseq | NP_005507.3 |
MIM | 143010 |
UniProt ID | P13747 |
◆ Recombinant Proteins | ||
HLA-E-1749H | Recombinant Human HLA-E Protein, MYC/DDK-tagged | +Inquiry |
HLA-E-039H | Recombinant Human HLA-E protein, His-Avi-tagged, Biotinylated | +Inquiry |
HLA-E-3602HF | Recombinant Full Length Human HLA-E Protein, GST-tagged | +Inquiry |
HLA-E-040HP | Recombinant Human HLA-E complex Protein (tetramer), His-Avi-tagged, PE-Labeled | +Inquiry |
HLA-E-2276H | Recombinant Human HLA-E protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-E-800HCL | Recombinant Human HLA-E cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HLA-E Products
Required fields are marked with *
My Review for All HLA-E Products
Required fields are marked with *
0
Inquiry Basket