Recombinant Full Length Human HMGB1 Protein, C-Flag-tagged
Cat.No. : | HMGB1-700HFL |
Product Overview : | Recombinant Full Length Human HMGB1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 24.7 kDa |
AA Sequence : | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKAR YEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADD KQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEE DDDDETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Protein Pathways : | Base excision repair |
Full Length : | Full L. |
Gene Name | HMGB1 high mobility group box 1 [ Homo sapiens (human) ] |
Official Symbol | HMGB1 |
Synonyms | HMG1; HMG3; HMG-1; SBP-1 |
Gene ID | 3146 |
mRNA Refseq | NM_002128.7 |
Protein Refseq | NP_002119.1 |
MIM | 163905 |
UniProt ID | P09429 |
◆ Recombinant Proteins | ||
HMGB1-118H | Recombinant Human HMGB1 Protein, Met1-Glu215, C-His tagged, Biotinylated | +Inquiry |
Hmgb1-1625M | Recombinant Mouse Hmgb1 Protein, His-tagged | +Inquiry |
HMGB1-3077H | Recombinant Human HMGB1 Protein (Met1-Glu215), N-His tagged | +Inquiry |
HMGB1-291H | Recombinant Human HMGB1 Protein, His-tagged | +Inquiry |
HMGB1-2108R | Recombinant Rhesus monkey HMGB1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
HMGB1-8447B | Active Native Bovine HMGB1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGB1-1677MCL | Recombinant Mouse HMGB1 cell lysate | +Inquiry |
HMGB1-2076HCL | Recombinant Human HMGB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMGB1 Products
Required fields are marked with *
My Review for All HMGB1 Products
Required fields are marked with *
0
Inquiry Basket