Recombinant Human HMGB1 protein(81-200 aa), C-His-tagged
Cat.No. : | HMGB1-2613H |
Product Overview : | Recombinant Human HMGB1 protein(P09429)(81-200 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 81-200 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | PKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEE |
Gene Name | HMGB1 high mobility group box 1 [ Homo sapiens ] |
Official Symbol | HMGB1 |
Synonyms | HMGB1; high mobility group box 1; high mobility group (nonhistone chromosomal) protein 1 , high mobility group box 1 , HMG1; high mobility group protein B1; Amphoterin; DKFZp686A04236; high mobility group protein 1; HMG3; SBP 1; Sulfoglucuronyl carbohydrate binding protein; HMG-1; high-mobility group box 1; high-mobility group (nonhistone chromosomal) protein 1; HMG1; SBP-1; |
Gene ID | 3146 |
mRNA Refseq | NM_002128 |
Protein Refseq | NP_002119 |
MIM | 163905 |
UniProt ID | P09429 |
◆ Native Proteins | ||
HMGB1-8447B | Active Native Bovine HMGB1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGB1-1677MCL | Recombinant Mouse HMGB1 cell lysate | +Inquiry |
HMGB1-2076HCL | Recombinant Human HMGB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMGB1 Products
Required fields are marked with *
My Review for All HMGB1 Products
Required fields are marked with *