Recombinant Full Length Human HMGN3 Protein, GST-tagged

Cat.No. : HMGN3-3661HF
Product Overview : Human HMGN3 full-length ORF ( AAH09529, 1 a.a. - 77 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 77 amino acids
Description : Thyroid hormone receptors are hormone-dependent transcription factors that regulate expression of a variety of specific target genes. The protein encoded by this gene binds thyroid hormone receptor beta, but only in the presence of thyroid hormone. The encoded protein, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 34.21 kDa
AA Sequence : MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTEN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HMGN3 high mobility group nucleosomal binding domain 3 [ Homo sapiens ]
Official Symbol HMGN3
Synonyms HMGN3; high mobility group nucleosomal binding domain 3; thyroid hormone receptor interactor 7 , TRIP7; high mobility group nucleosome-binding domain-containing protein 3; TR-interacting protein 7; thyroid hormone receptor interacting protein 7; TRIP7; PNAS-24; PNAS-25; FLJ42187; DKFZp686E20226;
Gene ID 9324
mRNA Refseq NM_001201362
Protein Refseq NP_001188291
MIM 604502
UniProt ID Q15651

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HMGN3 Products

Required fields are marked with *

My Review for All HMGN3 Products

Required fields are marked with *

0
cart-icon