Recombinant Human HMGN3 Protein, GST-tagged
Cat.No. : | HMGN3-4881H |
Product Overview : | Human HMGN3 full-length ORF ( AAH09529, 1 a.a. - 77 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Thyroid hormone receptors are hormone-dependent transcription factors that regulate expression of a variety of specific target genes. The protein encoded by this gene binds thyroid hormone receptor beta, but only in the presence of thyroid hormone. The encoded protein, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 34.21 kDa |
AA Sequence : | MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTEN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HMGN3 high mobility group nucleosomal binding domain 3 [ Homo sapiens ] |
Official Symbol | HMGN3 |
Synonyms | HMGN3; high mobility group nucleosomal binding domain 3; thyroid hormone receptor interactor 7 , TRIP7; high mobility group nucleosome-binding domain-containing protein 3; TR-interacting protein 7; thyroid hormone receptor interacting protein 7; TRIP7; PNAS-24; PNAS-25; FLJ42187; DKFZp686E20226; |
Gene ID | 9324 |
mRNA Refseq | NM_001201362 |
Protein Refseq | NP_001188291 |
MIM | 604502 |
UniProt ID | Q15651 |
◆ Recombinant Proteins | ||
HMGN3-1703Z | Recombinant Zebrafish HMGN3 | +Inquiry |
HMGN3-7380H | Recombinant Human HMGN3 protein, His-tagged | +Inquiry |
HMGN3-3661HF | Recombinant Full Length Human HMGN3 Protein, GST-tagged | +Inquiry |
HMGN3-4881H | Recombinant Human HMGN3 Protein, GST-tagged | +Inquiry |
Hmgn3-3415M | Recombinant Mouse Hmgn3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGN3-5472HCL | Recombinant Human HMGN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMGN3 Products
Required fields are marked with *
My Review for All HMGN3 Products
Required fields are marked with *
0
Inquiry Basket