Recombinant Human HMGN3 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | HMGN3-2468H |
| Product Overview : | HMGN3 MS Standard C13 and N15-labeled recombinant protein (NP_620058) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene binds thyroid hormone receptor beta in the presence of thyroid hormone. The encoded protein, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. There is a related pseudogene on chromosome 1. |
| Molecular Mass : | 8.4 kDa |
| AA Sequence : | MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTENTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | HMGN3 high mobility group nucleosomal binding domain 3 [ Homo sapiens (human) ] |
| Official Symbol | HMGN3 |
| Synonyms | HMGN3; high mobility group nucleosomal binding domain 3; thyroid hormone receptor interactor 7, TRIP7; high mobility group nucleosome-binding domain-containing protein 3; TR-interacting protein 7; thyroid hormone receptor interacting protein 7; TRIP7; PNAS-24; PNAS-25; FLJ42187; DKFZp686E20226; |
| Gene ID | 9324 |
| mRNA Refseq | NM_138730 |
| Protein Refseq | NP_620058 |
| MIM | 604502 |
| UniProt ID | Q15651 |
| ◆ Recombinant Proteins | ||
| HMGN3-1554C | Recombinant Chicken HMGN3 | +Inquiry |
| HMGN3-524H | Recombinant Human HMGN3 protein, MYC/DDK-tagged | +Inquiry |
| Hmgn3-1629M | Recombinant Mouse Hmgn3 Protein, His-tagged | +Inquiry |
| HMGN3-1703Z | Recombinant Zebrafish HMGN3 | +Inquiry |
| HMGN3-525H | Recombinant Human HMGN3 protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HMGN3-5472HCL | Recombinant Human HMGN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMGN3 Products
Required fields are marked with *
My Review for All HMGN3 Products
Required fields are marked with *
