Recombinant Full Length Human HMMR Protein, C-Flag-tagged
Cat.No. : | HMMR-1286HFL |
Product Overview : | Recombinant Full Length Human HMMR Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is involved in cell motility. It is expressed in breast tissue and together with other proteins, it forms a complex with BRCA1 and BRCA2, thus is potentially associated with higher risk of breast cancer. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 83.9 kDa |
AA Sequence : | MSFPKAPLKRFNDPSGCAPSPGAYDVKTLEVLKGPVSFQKSQRFKQQKESKQNLNVDKDTTLPASARKVK SSESKESQKNDKDLKILEKEIRVLLQERGAQDRRIQDLETELEKMEARLNAALREKTSLSANNATLEKQL IELTRTNELLKSKFSENGNQKNLRILSLELMKLRNKRETKMRGMMAKQEGMEMKLQVTQRSLEESQGKIA QLEGKLVSIEKEKIDEKSETEKLLEYIEEISCASDQVEKYKLDIAQLEENLKEKNDEILSLKQSLEENIV ILSKQVEDLNVKCQLLEKEKEDHVNRNREHNENLNAEMQNLKQKFILEQQEREKLQQKELQIDSLLQQEK ELSSSLHQKLCSFQEEMVKEKNLFEEELKQTLDELDKLQQKEEQAERLVKQLEEEAKSRAEELKLLEEKL KGKEAELEKSSAAHTQATLLLQEKYDSMVQSLEDVTAQFESYKALTASEIEDLKLENSSLQEKAAKAGKN AEDVQHQILATESSNQEYVRMLLDLQTKSALKETEIKEITVSFLQKITDLQNQLKQQEEDFRKQLEDEEG RKAEKENTTAELTEEINKWRLLYEELYNKTKPFQLQLDAFEVEKQALLNEHGAAQEQLNKIRDSYAKLLG HQNLKQKIKHVVKLKDENSQLKSEVSKLRCQLAKKKQSETKLQEELNKVLGIKHFDPSKAFHHESKENFA LKTPLKEGNTNCYRAPMECQESWKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways : | ECM-receptor interaction |
Full Length : | Full L. |
Gene Name | HMMR hyaluronan mediated motility receptor [ Homo sapiens (human) ] |
Official Symbol | HMMR |
Synonyms | CD168; IHABP; RHAMM |
Gene ID | 3161 |
mRNA Refseq | NM_012484.3 |
Protein Refseq | NP_036616.2 |
MIM | 600936 |
UniProt ID | O75330 |
◆ Recombinant Proteins | ||
HMMR-2776H | Recombinant Human HMMR Protein (Met1-Lys651), C-His tagged | +Inquiry |
HMMR-4247M | Recombinant Mouse HMMR Protein, His (Fc)-Avi-tagged | +Inquiry |
HMMR-7742M | Recombinant Mouse HMMR Protein | +Inquiry |
HMMR-6232H | Recombinant Human HMMR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Hmmr-01M | Recombinant Mouse Hmmr Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMMR-5469HCL | Recombinant Human HMMR 293 Cell Lysate | +Inquiry |
HMMR-5468HCL | Recombinant Human HMMR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMMR Products
Required fields are marked with *
My Review for All HMMR Products
Required fields are marked with *
0
Inquiry Basket