Recombinant Mouse Hmmr Protein, GST-tagged

Cat.No. : Hmmr-01M
Product Overview : Recombinant Mouse Hmmr Protein, fused to GST-tag, was expressed in E. coli.
Availability September 12, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : GST
Description : Predicted to enable hyaluronic acid binding activity. Predicted to be located in centrosome and cytosol. Is expressed in bulbar cushion and testis. Human ortholog(s) of this gene implicated in breast cancer. Orthologous to human HMMR (hyaluronan mediated motility receptor).
Form : Liquid. 20 mM Tris-HCl, 200 mM NaCl, pH8.0
Molecular Mass : ~32.5kD
AA Sequence : GST-tagged+GSGSLVPRGSIRDSYAQLLGHQNLKQKIKHVVKLKDENSQLKSEVSKLRSQLVKRKQNELRLQGELDKALGIRHFD
Purity : > 95% as determined by SDS-PAGE
Storage : Short term storage at 4 centigrade, Long term storage at -20 centigrade to -80 centigrade. Avoid freeze/thaw cycles.
Concentration : 1.2 mg/ml
Gene Name Hmmr hyaluronan mediated motility receptor (RHAMM) [ Mus musculus (house mouse) ]
Official Symbol HMMR
Synonyms CD168; Rhamm; AA386826
Gene ID 15366
mRNA Refseq NM_013552.2
Protein Refseq NP_038580.2
UniProt ID Q00547

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Hmmr Products

Required fields are marked with *

My Review for All Hmmr Products

Required fields are marked with *

0
cart-icon