Recombinant Mouse Hmmr Protein, GST-tagged
Cat.No. : | Hmmr-01M |
Product Overview : | Recombinant Mouse Hmmr Protein, fused to GST-tag, was expressed in E. coli. |
Availability | September 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | GST |
Description : | Predicted to enable hyaluronic acid binding activity. Predicted to be located in centrosome and cytosol. Is expressed in bulbar cushion and testis. Human ortholog(s) of this gene implicated in breast cancer. Orthologous to human HMMR (hyaluronan mediated motility receptor). |
Form : | Liquid. 20 mM Tris-HCl, 200 mM NaCl, pH8.0 |
Molecular Mass : | ~32.5kD |
AA Sequence : | GST-tagged+GSGSLVPRGSIRDSYAQLLGHQNLKQKIKHVVKLKDENSQLKSEVSKLRSQLVKRKQNELRLQGELDKALGIRHFD |
Purity : | > 95% as determined by SDS-PAGE |
Storage : | Short term storage at 4 centigrade, Long term storage at -20 centigrade to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 1.2 mg/ml |
Gene Name | Hmmr hyaluronan mediated motility receptor (RHAMM) [ Mus musculus (house mouse) ] |
Official Symbol | HMMR |
Synonyms | CD168; Rhamm; AA386826 |
Gene ID | 15366 |
mRNA Refseq | NM_013552.2 |
Protein Refseq | NP_038580.2 |
UniProt ID | Q00547 |
◆ Recombinant Proteins | ||
HMMR-2776H | Recombinant Human HMMR Protein (Met1-Lys651), C-His tagged | +Inquiry |
HMMR-4247M | Recombinant Mouse HMMR Protein, His (Fc)-Avi-tagged | +Inquiry |
HMMR-6232H | Recombinant Human HMMR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Hmmr-1140M | Recombinant Mouse Hmmr Protein, MYC/DDK-tagged | +Inquiry |
HMMR-4202H | Recombinant Human HMMR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMMR-5468HCL | Recombinant Human HMMR 293 Cell Lysate | +Inquiry |
HMMR-5469HCL | Recombinant Human HMMR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hmmr Products
Required fields are marked with *
My Review for All Hmmr Products
Required fields are marked with *