Recombinant Full Length Human HNRNPC Protein, C-Flag-tagged

Cat.No. : HNRNPC-562HFL
Product Overview : Recombinant Full Length Human HNRNPC Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene can act as a tetramer and is involved in the assembly of 40S hnRNP particles. Multiple transcript variants encoding at least two different isoforms have been described for this gene.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 33.5 kDa
AA Sequence : MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGE DGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQRDYYDRMYSYP ARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSL LENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESGGGADDSAEEGDLLDDDDNEDRGDDQL
ELIKDDEKEAEEGEDDRDSANGEDDSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Pathways : Spliceosome
Full Length : Full L.
Gene Name HNRNPC heterogeneous nuclear ribonucleoprotein C [ Homo sapiens (human) ]
Official Symbol HNRNPC
Synonyms C1; C2; HNRNP; HNRPC; SNRPC
Gene ID 3183
mRNA Refseq NM_031314.3
Protein Refseq NP_112604.2
MIM 164020
UniProt ID P07910

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HNRNPC Products

Required fields are marked with *

My Review for All HNRNPC Products

Required fields are marked with *

0
cart-icon
0
compare icon