Recombinant Full Length Human HOXA7 Protein, GST-tagged
Cat.No. : | HOXA7-3713HF |
Product Overview : | Human HOXA7 full-length ORF ( NP_008827.2, 1 a.a. - 230 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 230 amino acids |
Description : | In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. For example, the encoded protein represses the transcription of differentiation-specific genes during keratinocyte proliferation, but this repression is then overcome by differentiation signals. This gene is highly similar to the antennapedia (Antp) gene of Drosophila. [provided by RefSeq |
Molecular Mass : | 51.8 kDa |
AA Sequence : | MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFASTVPGLYNVNSPLYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALHGAAEANFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKDEGPTAAAAPEGAVPSAAATAAADKADEEDDDEEEEDEEE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HOXA7 homeobox A7 [ Homo sapiens ] |
Official Symbol | HOXA7 |
Synonyms | HOXA7; homeobox A7; homeo box A7 , HOX1, HOX1A; homeobox protein Hox-A7; homeo box A7; homeobox protein HOX-1A; homeobox protein Hox 1.1; ANTP; HOX1; HOX1A; HOX1.1; |
Gene ID | 3204 |
mRNA Refseq | NM_006896 |
Protein Refseq | NP_008827 |
MIM | 142950 |
UniProt ID | P31268 |
◆ Recombinant Proteins | ||
HOXA7-6164C | Recombinant Chicken HOXA7 | +Inquiry |
HOXA7-7793M | Recombinant Mouse HOXA7 Protein | +Inquiry |
HOXA7-4283M | Recombinant Mouse HOXA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
HOXA7-3713HF | Recombinant Full Length Human HOXA7 Protein, GST-tagged | +Inquiry |
HOXA7-4943H | Recombinant Human HOXA7 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXA7-809HCL | Recombinant Human HOXA7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HOXA7 Products
Required fields are marked with *
My Review for All HOXA7 Products
Required fields are marked with *
0
Inquiry Basket