Recombinant Full Length Human HOXA7 Protein, GST-tagged

Cat.No. : HOXA7-3713HF
Product Overview : Human HOXA7 full-length ORF ( NP_008827.2, 1 a.a. - 230 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 230 amino acids
Description : In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. For example, the encoded protein represses the transcription of differentiation-specific genes during keratinocyte proliferation, but this repression is then overcome by differentiation signals. This gene is highly similar to the antennapedia (Antp) gene of Drosophila. [provided by RefSeq
Molecular Mass : 51.8 kDa
AA Sequence : MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFASTVPGLYNVNSPLYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALHGAAEANFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKDEGPTAAAAPEGAVPSAAATAAADKADEEDDDEEEEDEEE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HOXA7 homeobox A7 [ Homo sapiens ]
Official Symbol HOXA7
Synonyms HOXA7; homeobox A7; homeo box A7 , HOX1, HOX1A; homeobox protein Hox-A7; homeo box A7; homeobox protein HOX-1A; homeobox protein Hox 1.1; ANTP; HOX1; HOX1A; HOX1.1;
Gene ID 3204
mRNA Refseq NM_006896
Protein Refseq NP_008827
MIM 142950
UniProt ID P31268

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXA7 Products

Required fields are marked with *

My Review for All HOXA7 Products

Required fields are marked with *

0
cart-icon