Recombinant Full Length Human HOXA9 Protein, C-Flag-tagged
Cat.No. : | HOXA9-1990HFL |
Product Overview : | Recombinant Full Length Human HOXA9 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is highly similar to the abdominal-B (Abd-B) gene of Drosophila. A specific translocation event which causes a fusion between this gene and the NUP98 gene has been associated with myeloid leukemogenesis. Read-through transcription exists between this gene and the upstream homeobox A10 (HOXA10) gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 30 kDa |
AA Sequence : | MATTGALGNYYVDSFLLGADAADELSVGRYAPGTLGQPPRQAATLAEHPDFSPCSFQSKATVFGASWNPV HAAGANAVPAAVYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSAR RGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPPIDPNNPAANWLHARSTRKKR CPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | HOXA9 homeobox A9 [ Homo sapiens (human) ] |
Official Symbol | HOXA9 |
Synonyms | HOX1; ABD-B; HOX1G; HOX1.7 |
Gene ID | 3205 |
mRNA Refseq | NM_152739.4 |
Protein Refseq | NP_689952.1 |
MIM | 142956 |
UniProt ID | P31269 |
◆ Recombinant Proteins | ||
HOXA9-162H | Recombinant Human HOXA9 protein, T7/His-tagged | +Inquiry |
HOXA9-1920H | Recombinant Human HOXA9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HOXA9-7794M | Recombinant Mouse HOXA9 Protein | +Inquiry |
HOXA9-3714HF | Recombinant Full Length Human HOXA9 Protein, GST-tagged | +Inquiry |
Hoxa9-1154M | Recombinant Mouse Hoxa9 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXA9-335HCL | Recombinant Human HOXA9 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HOXA9 Products
Required fields are marked with *
My Review for All HOXA9 Products
Required fields are marked with *
0
Inquiry Basket