Recombinant Human HOXA9 protein, T7/His-tagged

Cat.No. : HOXA9-162H
Product Overview : Recombinant human HoxA9 cDNA (272aa) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFATTGALGNYYVDSFLLGADAADELSVGRYAPGTLGQPPRQAATLAE HPDFSPCSFQSKATVFGASWNPVHAAGANAVPAAVYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFA GLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPPIDPNNPA ANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE
Purity : >90% by SDS-PAGE
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name HOXA9 homeobox A9 [ Homo sapiens ]
Official Symbol HOXA9
Synonyms HOXA9; homeobox A9; homeo box A9 , HOX1, HOX1G; homeobox protein Hox-A9; homeobox protein Hox-1G; homeodomain protein HOXA9; HOX1; ABD-B; HOX1G; HOX1.7; MGC1934;
Gene ID 3205
mRNA Refseq NM_152739
Protein Refseq NP_689952
MIM 142956
UniProt ID P31269
Chromosome Location 7p15.2
Pathway TGF-beta Receptor Signaling Pathway, organism-specific biosystem; Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem;
Function protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXA9 Products

Required fields are marked with *

My Review for All HOXA9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon