Recombinant Full Length Human HOXB6 Protein, C-Flag-tagged
Cat.No. : | HOXB6-2150HFL |
Product Overview : | Recombinant Full Length Human HOXB6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development, including that of lung and skin, and has been localized to both the nucleus and cytoplasm. Altered expression of this gene or a change in the subcellular localization of its protein is associated with some cases of acute myeloid leukemia and colorectal cancer. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 25.3 kDa |
AA Sequence : | MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSSYYPPAGGGYGRAA PCDYGPAPAFYREKESACALSGADEQPPFHPEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCNSS SFGPSGRRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKLLSA SQLSAEEEEEKQAE myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | HOXB6 homeobox B6 [ Homo sapiens (human) ] |
Official Symbol | HOXB6 |
Synonyms | HOX2; HU-2; HOX2B; Hox-2.2 |
Gene ID | 3216 |
mRNA Refseq | NM_018952.5 |
Protein Refseq | NP_061825.2 |
MIM | 142961 |
UniProt ID | P17509 |
◆ Recombinant Proteins | ||
HOXB6-13899H | Recombinant Human HOXB6, GST-tagged | +Inquiry |
HOXB6-1092H | Recombinant Human HOXB6 Protein, His (Fc)-Avi-tagged | +Inquiry |
HOXB6-2150HFL | Recombinant Full Length Human HOXB6 Protein, C-Flag-tagged | +Inquiry |
HOXB6-3719HF | Recombinant Full Length Human HOXB6 Protein, GST-tagged | +Inquiry |
HOXB6-4964H | Recombinant Human HOXB6 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXB6-5421HCL | Recombinant Human HOXB6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HOXB6 Products
Required fields are marked with *
My Review for All HOXB6 Products
Required fields are marked with *
0
Inquiry Basket