Recombinant Full Length Human HOXB6 Protein, GST-tagged

Cat.No. : HOXB6-3719HF
Product Overview : Human HOXB6 full-length ORF ( AAH14651, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 224 amino acids
Description : This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development, including that of lung and skin, and has been localized to both the nucleus and cytoplasm. Altered expression of this gene or a change in the subcellular localization of its protein is associated with some cases of acute myeloid leukemia and colorectal cancer. [provided by RefSeq
Molecular Mass : 50.27 kDa
AA Sequence : MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSSYYPPAGGGYGRAAPCDYGPAPAFYREKESACALSGADEQPPFHPEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCNSSSFGPSGRRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKLLSASQLSAEEEEEKQAE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HOXB6 homeobox B6 [ Homo sapiens ]
Official Symbol HOXB6
Synonyms HOXB6; homeobox B6; homeo box B6 , HOX2, HOX2B; homeobox protein Hox-B6; homeo box 2B; homeo box B6; homeobox protein Hu-2; homeobox protein Hox-2B; homeobox protein Hox-2.2; HOX2; HU-2; HOX2B; Hox-2.2;
Gene ID 3216
mRNA Refseq NM_018952
Protein Refseq NP_061825
MIM 142961
UniProt ID P17509

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXB6 Products

Required fields are marked with *

My Review for All HOXB6 Products

Required fields are marked with *

0
cart-icon