Recombinant Human HOXB6 Protein, GST-tagged
Cat.No. : | HOXB6-4964H |
Product Overview : | Human HOXB6 full-length ORF ( AAH14651, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development, including that of lung and skin, and has been localized to both the nucleus and cytoplasm. Altered expression of this gene or a change in the subcellular localization of its protein is associated with some cases of acute myeloid leukemia and colorectal cancer. [provided by RefSeq |
Molecular Mass : | 50.27 kDa |
AA Sequence : | MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSSYYPPAGGGYGRAAPCDYGPAPAFYREKESACALSGADEQPPFHPEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCNSSSFGPSGRRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKLLSASQLSAEEEEEKQAE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HOXB6 homeobox B6 [ Homo sapiens ] |
Official Symbol | HOXB6 |
Synonyms | HOXB6; homeobox B6; homeo box B6 , HOX2, HOX2B; homeobox protein Hox-B6; homeo box 2B; homeo box B6; homeobox protein Hu-2; homeobox protein Hox-2B; homeobox protein Hox-2.2; HOX2; HU-2; HOX2B; Hox-2.2; |
Gene ID | 3216 |
mRNA Refseq | NM_018952 |
Protein Refseq | NP_061825 |
MIM | 142961 |
UniProt ID | P17509 |
◆ Recombinant Proteins | ||
HOXB6-4964H | Recombinant Human HOXB6 Protein, GST-tagged | +Inquiry |
HOXB6-1092H | Recombinant Human HOXB6 Protein, His (Fc)-Avi-tagged | +Inquiry |
HOXB6-2150HFL | Recombinant Full Length Human HOXB6 Protein, C-Flag-tagged | +Inquiry |
HOXB6-13899H | Recombinant Human HOXB6, GST-tagged | +Inquiry |
HOXB6-6295H | Recombinant Human HOXB6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXB6-5421HCL | Recombinant Human HOXB6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOXB6 Products
Required fields are marked with *
My Review for All HOXB6 Products
Required fields are marked with *