Recombinant Human HOXB6 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : HOXB6-6295H
Product Overview : HOXB6 MS Standard C13 and N15-labeled recombinant protein (NP_061825) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development, including that of lung and skin, and has been localized to both the nucleus and cytoplasm. Altered expression of this gene or a change in the subcellular localization of its protein is associated with some cases of acute myeloid leukemia and colorectal cancer.
Molecular Mass : 25.4 kDa
AA Sequence : MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSSYYPPAGGGYGRAAPCDYGPAPAFYREKESACALSGADEQPPFHPEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCNSSSFGPSGRRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKLLSASQLSAEEEEEKQAETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name HOXB6 homeobox B6 [ Homo sapiens (human) ]
Official Symbol HOXB6
Synonyms HOXB6; homeobox B6; homeo box B6, HOX2, HOX2B; homeobox protein Hox-B6; homeo box 2B; homeo box B6; homeobox protein Hu-2; homeobox protein Hox-2B; homeobox protein Hox-2.2; HOX2; HU-2; HOX2B; Hox-2.2;
Gene ID 3216
mRNA Refseq NM_018952
Protein Refseq NP_061825
MIM 142961
UniProt ID P17509

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXB6 Products

Required fields are marked with *

My Review for All HOXB6 Products

Required fields are marked with *

0
cart-icon
0
compare icon