Recombinant Full Length Human HPN Protein, GST-tagged
Cat.No. : | HPN-3626HF |
Product Overview : | Human HPN full-length ORF ( AAH25716.1, 40 a.a. - 417 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 417 amino acids |
Description : | This gene encodes a type II transmembrane serine protease. The encoded protein has an extracellular region that consists of two domains, a catalytic serine protease domain and a non-catalytic scavenger receptor cysteine-rich domain. This protein may be involved in diverse cellular functions including blood coagulation, maintenance of cell morphology and the growth and progression of certain cancers, particularly prostate cancer. Alternative splicing results in multiple transcript variants |
Molecular Mass : | 67.43 kDa |
AA Sequence : | VAVLLRSDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFACEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HPN hepsin [ Homo sapiens ] |
Official Symbol | HPN |
Synonyms | HPN; hepsin; serine protease hepsin; TMPRSS1; transmembrane protease; serine 1; transmembrane protease serine 1; transmembrane protease, serine 1; serine protease hepsin catalytic chain; serine protease hepsin non-catalytic chain; |
Gene ID | 3249 |
mRNA Refseq | NM_002151 |
Protein Refseq | NP_002142 |
MIM | 142440 |
UniProt ID | P05981 |
◆ Recombinant Proteins | ||
HPN-2904R | Recombinant Rat HPN Protein | +Inquiry |
HPN-7831M | Recombinant Mouse HPN protein, His-tagged | +Inquiry |
HPN-3121H | Recombinant Human HPN Protein, His (Fc)-Avi-tagged | +Inquiry |
HPN-148H | Active Recombinant Human HPN Protein, His-tagged | +Inquiry |
HPN-4308M | Recombinant Mouse HPN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HPN-5400HCL | Recombinant Human HPN 293 Cell Lysate | +Inquiry |
HPN-5399HCL | Recombinant Human HPN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HPN Products
Required fields are marked with *
My Review for All HPN Products
Required fields are marked with *