Recombinant Full Length Human Serine Protease Hepsin(Hpn) Protein, His-Tagged
Cat.No. : | RFL11339HF |
Product Overview : | Recombinant Full Length Human Serine protease hepsin(HPN) Protein (P05981) (1-417aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-417) |
Form : | Lyophilized powder |
AA Sequence : | MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HPN |
Synonyms | HPN; TMPRSS1; Serine protease hepsin; Transmembrane protease serine 1 |
UniProt ID | P05981 |
◆ Recombinant Proteins | ||
HPN-2904R | Recombinant Rat HPN Protein | +Inquiry |
HPN-148H | Active Recombinant Human HPN Protein, His-tagged | +Inquiry |
HPN-3121H | Recombinant Human HPN Protein, His (Fc)-Avi-tagged | +Inquiry |
HPN-2559R | Recombinant Rat HPN Protein, His (Fc)-Avi-tagged | +Inquiry |
HPN-3626HF | Recombinant Full Length Human HPN Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HPN-5399HCL | Recombinant Human HPN 293 Cell Lysate | +Inquiry |
HPN-5400HCL | Recombinant Human HPN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HPN Products
Required fields are marked with *
My Review for All HPN Products
Required fields are marked with *
0
Inquiry Basket