Recombinant Full Length Human HRASLS Protein, GST-tagged
| Cat.No. : | HRASLS-3651HF |
| Product Overview : | Human HRASLS full-length ORF ( NP_065119.1, 1 a.a. - 168 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 168 amino acids |
| Description : | HRASLS (HRAS Like Suppressor) is a Protein Coding gene. Among its related pathways are Acyl chain remodelling of PE and Glycerophospholipid biosynthesis. GO annotations related to this gene include hydrolase activity and phospholipase activity. An important paralog of this gene is RARRES3. |
| Molecular Mass : | 45.2 kDa |
| AA Sequence : | MAFNDCFSLNYPGNPCPGDLIEVFRPGYQHWALYLGDGYVINIAPVDGIPASFTSAKSVFSSKALVKMQLLKDVVGNDTYRINNKYDETYPPLPVEEIIKRSEFVIGQEVAYNLLVNNCEHFVTLLRYGEGVSEQANRAISTVEFVTAAVGVFSFLGLFPKGQRAKYY |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HRASLS HRAS-like suppressor [ Homo sapiens ] |
| Official Symbol | HRASLS |
| Synonyms | HRASLS; HRAS-like suppressor; H REV107; HRASLS1; phospholipase A; H-REV107 protein-related protein; A-C1; HSD28; H-REV107; |
| Gene ID | 57110 |
| mRNA Refseq | NM_020386 |
| Protein Refseq | NP_065119 |
| MIM | 606487 |
| UniProt ID | Q9HDD0 |
| ◆ Recombinant Proteins | ||
| HRASLS-3651HF | Recombinant Full Length Human HRASLS Protein, GST-tagged | +Inquiry |
| HRASLS-707Z | Recombinant Zebrafish HRASLS | +Inquiry |
| HRASLS-4314M | Recombinant Mouse HRASLS Protein, His (Fc)-Avi-tagged | +Inquiry |
| HRASLS-5025H | Recombinant Human HRASLS Protein, GST-tagged | +Inquiry |
| HRASLS-7843M | Recombinant Mouse HRASLS Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HRASLS-816HCL | Recombinant Human HRASLS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HRASLS Products
Required fields are marked with *
My Review for All HRASLS Products
Required fields are marked with *
