Recombinant Human HRASLS Protein, GST-tagged

Cat.No. : HRASLS-5025H
Product Overview : Human HRASLS full-length ORF ( NP_065119.1, 1 a.a. - 168 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : HRASLS (HRAS Like Suppressor) is a Protein Coding gene. Among its related pathways are Acyl chain remodelling of PE and Glycerophospholipid biosynthesis. GO annotations related to this gene include hydrolase activity and phospholipase activity. An important paralog of this gene is RARRES3.
Molecular Mass : 45.2 kDa
AA Sequence : MAFNDCFSLNYPGNPCPGDLIEVFRPGYQHWALYLGDGYVINIAPVDGIPASFTSAKSVFSSKALVKMQLLKDVVGNDTYRINNKYDETYPPLPVEEIIKRSEFVIGQEVAYNLLVNNCEHFVTLLRYGEGVSEQANRAISTVEFVTAAVGVFSFLGLFPKGQRAKYY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HRASLS HRAS-like suppressor [ Homo sapiens ]
Official Symbol HRASLS
Synonyms HRASLS; HRAS-like suppressor; H REV107; HRASLS1; phospholipase A; H-REV107 protein-related protein; A-C1; HSD28; H-REV107;
Gene ID 57110
mRNA Refseq NM_020386
Protein Refseq NP_065119
MIM 606487
UniProt ID Q9HDD0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HRASLS Products

Required fields are marked with *

My Review for All HRASLS Products

Required fields are marked with *

0
cart-icon