Recombinant Full Length Human HRK Protein, GST-tagged
| Cat.No. : | HRK-3670HF |
| Product Overview : | Human HRK full-length ORF ( AAI11924.1, 1 a.a. - 91 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 91 amino acids |
| Description : | Activator of apoptosis Hrk regulates apoptosis through interaction with death-repressor proteins Bcl-2 and Bcl-X(L). The HRK protein lacks significant homology to other BCL2 family members except for an 8-amino acid region that was similar to the BCL2 homology domain-3 (BH3) motif of BIK. HRK interacts with BCL2 and BCLXL via the BH3 domain, but not with the death-promoting BCL2-related proteins BAX, BAK, or BCLXS. HRK localizes to membranes of intracellular organelles in a pattern similar to that previously reported for BCL2 and BCLXL. [provided by RefSeq |
| Molecular Mass : | 36.41 kDa |
| AA Sequence : | MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HRK harakiri, BCL2 interacting protein (contains only BH3 domain) [ Homo sapiens ] |
| Official Symbol | HRK |
| Synonyms | HRK; harakiri, BCL2 interacting protein (contains only BH3 domain); activator of apoptosis harakiri; death protein 5; DP5; BCL2-interacting protein; activator of apoptosis Hrk; neuronal death protein DP5; BH3-interacting domain-containing protein 3; HARAKIRI; |
| Gene ID | 8739 |
| mRNA Refseq | NM_003806 |
| Protein Refseq | NP_003797 |
| MIM | 603447 |
| UniProt ID | O00198 |
| ◆ Recombinant Proteins | ||
| RFL33284MF | Recombinant Full Length Mouse Activator Of Apoptosis Harakiri(Hrk) Protein, His-Tagged | +Inquiry |
| HRK-3114H | Recombinant Human HRK, GST-tagged | +Inquiry |
| HRK-3670HF | Recombinant Full Length Human HRK Protein, GST-tagged | +Inquiry |
| HRK-645H | Recombinant Human HRK | +Inquiry |
| RFL7252RF | Recombinant Full Length Rat Activator Of Apoptosis Harakiri(Hrk) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HRK-5391HCL | Recombinant Human HRK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HRK Products
Required fields are marked with *
My Review for All HRK Products
Required fields are marked with *
