Recombinant Full Length Human HS1BP3 Protein, GST-tagged
Cat.No. : | HS1BP3-3690HF |
Product Overview : | Human HS1BP3 full-length ORF ( AAH27947, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 213 amino acids |
Description : | The protein encoded by this gene shares similarity with mouse Hs1bp3, an Hcls1/Hs1-interacting protein that may be involved in lymphocyte activation. [provided by RefSeq |
Molecular Mass : | 49.17 kDa |
AA Sequence : | MQSPAVLVTSRRLQNAHTGLDLTVPQHQEVRGKMMSGHVEYQILVVTRLAAFKSAKHRPEDVVQFLVSKKYSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQVAEEGPPVQSLKGEDAEESLEEEEALDPLGIMRLVSCC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HS1BP3 HCLS1 binding protein 3 [ Homo sapiens ] |
Official Symbol | HS1BP3 |
Synonyms | HS1BP3; HCLS1 binding protein 3; HCLS1-binding protein 3; HS1 BP3; FLJ14249; HSP1BP-3; HS1-binding protein 3; ETM2; HS1-BP3; |
Gene ID | 64342 |
mRNA Refseq | NM_022460 |
Protein Refseq | NP_071905 |
MIM | 609359 |
UniProt ID | Q53T59 |
◆ Recombinant Proteins | ||
HS1BP3-7854M | Recombinant Mouse HS1BP3 Protein | +Inquiry |
HS1BP3-5046H | Recombinant Human HS1BP3 Protein, GST-tagged | +Inquiry |
HS1BP3-4321M | Recombinant Mouse HS1BP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
HS1BP3-6446H | Recombinant Human HS1BP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HS1BP3-3690HF | Recombinant Full Length Human HS1BP3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HS1BP3-5389HCL | Recombinant Human HS1BP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HS1BP3 Products
Required fields are marked with *
My Review for All HS1BP3 Products
Required fields are marked with *
0
Inquiry Basket