Recombinant Human HS1BP3 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | HS1BP3-6446H |
| Product Overview : | HS1BP3 MS Standard C13 and N15-labeled recombinant protein (NP_071905) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene shares similarity with mouse Hs1bp3, an Hcls1/Hs1-interacting protein that may be involved in lymphocyte activation. |
| Molecular Mass : | 42.8 kDa |
| AA Sequence : | MQSPAVLVTSRRLQNAHTGLDLTVPQHQEVRGKMMSGHVEYQILVVTRLAAFKSAKHRPEDVVQFLVSKKYSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQVAEEGPPVQSLKGEDAEESLEEEEALDPLGIMRSKKPKKHPKVAVKAKPSPRLTIFDEEVDPDEGLFGPGRKLSPQDPSEDVSSMDPLKLFDDPDLGGAIPLGDSLLLPAACESGGPTPSLSHRDASKELFRVEEDLDQILNLGAEPKPKPQLKPKPPVAAKPVIPRKPAVPPKAGPAEAVAGQQKPQEQIQAMDEMDILQYIQDHDTPAQATPSLFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | HS1BP3 HCLS1 binding protein 3 [ Homo sapiens (human) ] |
| Official Symbol | HS1BP3 |
| Synonyms | HS1BP3; HCLS1 binding protein 3; HCLS1-binding protein 3; HS1 BP3; FLJ14249; HSP1BP-3; HS1-binding protein 3; ETM2; HS1-BP3; |
| Gene ID | 64342 |
| mRNA Refseq | NM_022460 |
| Protein Refseq | NP_071905 |
| MIM | 609359 |
| UniProt ID | Q53T59 |
| ◆ Recombinant Proteins | ||
| Hs1bp3-3439M | Recombinant Mouse Hs1bp3 Protein, Myc/DDK-tagged | +Inquiry |
| HS1BP3-3690HF | Recombinant Full Length Human HS1BP3 Protein, GST-tagged | +Inquiry |
| HS1BP3-4321M | Recombinant Mouse HS1BP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HS1BP3-8133Z | Recombinant Zebrafish HS1BP3 | +Inquiry |
| HS1BP3-6446H | Recombinant Human HS1BP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HS1BP3-5389HCL | Recombinant Human HS1BP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HS1BP3 Products
Required fields are marked with *
My Review for All HS1BP3 Products
Required fields are marked with *
