Recombinant Human HS1BP3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : HS1BP3-6446H
Product Overview : HS1BP3 MS Standard C13 and N15-labeled recombinant protein (NP_071905) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene shares similarity with mouse Hs1bp3, an Hcls1/Hs1-interacting protein that may be involved in lymphocyte activation.
Molecular Mass : 42.8 kDa
AA Sequence : MQSPAVLVTSRRLQNAHTGLDLTVPQHQEVRGKMMSGHVEYQILVVTRLAAFKSAKHRPEDVVQFLVSKKYSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQVAEEGPPVQSLKGEDAEESLEEEEALDPLGIMRSKKPKKHPKVAVKAKPSPRLTIFDEEVDPDEGLFGPGRKLSPQDPSEDVSSMDPLKLFDDPDLGGAIPLGDSLLLPAACESGGPTPSLSHRDASKELFRVEEDLDQILNLGAEPKPKPQLKPKPPVAAKPVIPRKPAVPPKAGPAEAVAGQQKPQEQIQAMDEMDILQYIQDHDTPAQATPSLFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name HS1BP3 HCLS1 binding protein 3 [ Homo sapiens (human) ]
Official Symbol HS1BP3
Synonyms HS1BP3; HCLS1 binding protein 3; HCLS1-binding protein 3; HS1 BP3; FLJ14249; HSP1BP-3; HS1-binding protein 3; ETM2; HS1-BP3;
Gene ID 64342
mRNA Refseq NM_022460
Protein Refseq NP_071905
MIM 609359
UniProt ID Q53T59

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HS1BP3 Products

Required fields are marked with *

My Review for All HS1BP3 Products

Required fields are marked with *

0
cart-icon
0
compare icon