Recombinant Full Length Human HS2ST1 Protein, GST-tagged

Cat.No. : HS2ST1-3691HF
Product Overview : Human HS2ST1 full-length ORF ( AAH25990.1, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 229 amino acids
Description : Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. This gene encodes a member of the heparan sulfate biosynthetic enzyme family that transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation. Two alternatively spliced transcript variants that encode different proteins have been found for this gene. [provided by RefSeq
Molecular Mass : 53.2 kDa
AA Sequence : MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDEEEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQDQVRFVKNITSWKEMKPGFYHGHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECW
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HS2ST1 heparan sulfate 2-O-sulfotransferase 1 [ Homo sapiens ]
Official Symbol HS2ST1
Synonyms HS2ST1; heparan sulfate 2-O-sulfotransferase 1; KIAA0448; 2OST; 2-O-sulfotransferase; dJ604K5.2; FLJ11317; MGC131986;
Gene ID 9653
mRNA Refseq NM_001134492
Protein Refseq NP_001127964
MIM 604844
UniProt ID Q7LGA3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HS2ST1 Products

Required fields are marked with *

My Review for All HS2ST1 Products

Required fields are marked with *

0
cart-icon