Recombinant Full Length Human HSD17B10 Protein, GST-tagged

• Cat.No.: HSD17B10-3805HF
• Product Overview: Human HSD17B10 full-length ORF ( NP_004484.1, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 261 amino acids
• Description: This gene encodes 3-hydroxyacyl-CoA dehydrogenase type II, a member of the short-chain dehydrogenase/reductase superfamily. The gene product is a mitochondrial protein that catalyzes the oxidation of a wide variety of fatty acids, alcohols, and steroids. The protein has been implicated in the development of Alzheimers disease, and mutations in the gene are the cause of 2-methyl-3-hydroxybutyryl-CoA dehydrogenase deficiency (MHBD). Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined. [provided by RefSeq
• Molecular Mass: 53.3 kDa
• AA Sequence: MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HSD17B10 hydroxysteroid (17-beta) dehydrogenase 10 [ Homo sapiens ]
• Official Symbol: HSD17B10
• Synonyms: HSD17B10; hydroxysteroid (17-beta) dehydrogenase 10; HADH2, hydroxyacyl Coenzyme A dehydrogenase, type II, hydroxyacyl Coenzyme A dehydrogenase, type II , mental retardation, X linked, syndromic 10 , MRXS10; 3-hydroxyacyl-CoA dehydrogenase type-2; 17b HSD10; AB binding alcohol dehydrogenase; ABAD; CAMR; ERAB; MHBD; MRPP2; SDR5C1; short chain dehydrogenase/reductase family 5C; member 1; type 10 17b HSD; type 10 17beta hydroxysteroid dehydrogenase; AB-binding alcohol dehydrogenase; mitochondrial ribonuclease P protein 2; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; short chain type dehydrogenase/reductase XH98G2; amyloid-beta peptide binding alcohol dehydrogenase; short chain L-3-hydroxyacyl-CoA dehydrogenase type 2; short chain dehydrogenase/reductase family 5C, member 1; endoplasmic reticulum-associated amyloid beta-peptide-binding protein; HCD2; HADH2; MRX17; MRX31; SCHAD; MRXS10; 17b-HSD10; DUPXp11.22
• Gene ID: 3028
• mRNA Refseq: NM_001037811
• Protein Refseq: NP_001032900
• MIM: 300256
• UniProt ID: Q99714