Recombinant Full Length Human HSP90AA1 Protein, C-Flag-tagged
Cat.No. : | HSP90AA1-987HFL |
Product Overview : | Recombinant Full Length Human HSP90AA1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is an inducible molecular chaperone that functions as a homodimer. The encoded protein aids in the proper folding of specific target proteins by use of an ATPase activity that is modulated by co-chaperones. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 84.5 kDa |
AA Sequence : | MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKL DSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYS AYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKH SQFIGYPITLFVEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKI KEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFD LFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKC LELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKH IYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKK QEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAA KKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDE DDPTADDTSAAVTEEMPPLEGDDDTSRMEEVDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Antigen processing and presentation, NOD-like receptor signaling pathway, Pathways in cancer, Progesterone-mediated oocyte maturation, Prostate cancer |
Full Length : | Full L. |
Gene Name | HSP90AA1 heat shock protein 90 alpha family class A member 1 [ Homo sapiens (human) ] |
Official Symbol | HSP90AA1 |
Synonyms | EL52; HSPN; LAP2; HSP86; HSPC1; HSPCA; Hsp89; Hsp90; LAP-2; HSP89A; HSP90A; HSP90N; Hsp103; HSPCAL1; HSPCAL4; HEL-S-65p |
Gene ID | 3320 |
mRNA Refseq | NM_005348.4 |
Protein Refseq | NP_005339.3 |
MIM | 140571 |
UniProt ID | P07900 |
◆ Recombinant Proteins | ||
EI-1053 | Herbimycin A | +Inquiry |
HSP90AA1-2641H | Recombinant Human HSP90AA1 Protein (Met1-Asp732), N-His tagged | +Inquiry |
HSP90AA1-136H | Recombinant Human HSP90AA1 protein, MYC/DDK-tagged | +Inquiry |
HSP90AA1-27843TH | Recombinant Human HSP90AA1 | +Inquiry |
Hsp90aa1-1190M | Recombinant Mouse Hsp90aa1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
HSP90AA1-14H | Native Hsp90 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSP90AA1-5362HCL | Recombinant Human HSP90AA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSP90AA1 Products
Required fields are marked with *
My Review for All HSP90AA1 Products
Required fields are marked with *
0
Inquiry Basket