Recombinant Full Length Human HSP90B1 Protein, C-Flag-tagged
Cat.No. : | HSP90B1-1111HFL |
Product Overview : | Recombinant Full Length Human HSP90B1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of a family of adenosine triphosphate(ATP)-metabolizing molecular chaperones with roles in stabilizing and folding other proteins. The encoded protein is localized to melanosomes and the endoplasmic reticulum. Expression of this protein is associated with a variety of pathogenic states, including tumor formation. There is a microRNA gene located within the 5' exon of this gene. There are pseudogenes for this gene on chromosomes 1 and 15. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 90.1 kDa |
AA Sequence : | MRALWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELR EKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALSGNEELTVKIKCDK EKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVI VTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIY VWSSKTETVEEPMEEEEAAKEEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEV EEDEYKAFYKSFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITD DFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKYNDTFWKEFGT NIKLGVIEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVERLLK KGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESEKTKESREAVEKEFEPLLNWMKDKALKDK IEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRR IKEDEDDKTVLDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETAEDT TEDTEQDEDEEMDVGTDEEEETAKESTAEKDELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | NOD-like receptor signaling pathway, Pathways in cancer, Prostate cancer |
Full Length : | Full L. |
Gene Name | HSP90B1 heat shock protein 90 beta family member 1 [ Homo sapiens (human) ] |
Official Symbol | HSP90B1 |
Synonyms | ECGP; GP96; TRA1; GRP94; HEL35; HEL-S-125m |
Gene ID | 7184 |
mRNA Refseq | NM_003299.3 |
Protein Refseq | NP_003290.1 |
MIM | 191175 |
UniProt ID | P14625 |
◆ Recombinant Proteins | ||
HSP90B1-2941R | Recombinant Rat HSP90B1 Protein | +Inquiry |
HSP90B1-5862C | Recombinant Chicken HSP90B1 | +Inquiry |
Hsp90b1-3449M | Recombinant Mouse Hsp90b1 Protein, Myc/DDK-tagged | +Inquiry |
HSP90B1-27413TH | Recombinant Human HSP90B1, His-tagged | +Inquiry |
HSP90B1-338H | Recombinant Human Heat Shock Protein 90kDa Beta (Grp94), Member 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSP90B1-5360HCL | Recombinant Human HSP90B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSP90B1 Products
Required fields are marked with *
My Review for All HSP90B1 Products
Required fields are marked with *
0
Inquiry Basket